PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_24_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GRAS
Protein Properties Length: 573aa    MW: 64350.6 Da    PI: 4.8781
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_24_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.21.8e-1352045732374
                               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknssee 77 
                                        ++ L+ cA+a+++g+ ++a+++++ l++ +s +gdp +R+aay++eALaar+a s+++lykal+++e +   s ++
  cra_locus_24_iso_5_len_2218_ver_3 204 KQMLFGCATAIQEGNISEASTMINMLRQKVSIQGDPSERIAAYMVEALAARMAISGKGLYKALKCKEPP---SYDR 276
                                        689*****************************************************************9...9*** PP

                               GRAS  78 laalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg 153
                                        laa+++++ev+P+++f++++aN aIlea++ge+rvHi+Dfdi+qG Q+ +Llq+La  p +p +lR+Tgv++pes+
  cra_locus_24_iso_5_len_2218_ver_3 277 LAAMQVLFEVCPCFRFGFMAANGAILEAFKGEKRVHIVDFDINQGSQYYTLLQTLARLPYKPTHLRLTGVDDPESV 352
                                        **************************************************************************99 PP

                               GRAS 154 ..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdev 227
                                              l+++g+rL+ +A  l++pfef + va +++d+++ +L +kpg+al+Vn+++qlh+++desvs+ ++rd++
  cra_locus_24_iso_5_len_2218_ver_3 353 qrAVGGLKNIGQRLETLAGDLEIPFEFCA-VAAKTADVTPAMLGCKPGDALIVNFAFQLHHMPDESVSTVNQRDRL 427
                                        878889***********************.7999****************************************** PP

                               GRAS 228 LklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacega 303
                                        L++vksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+fdsl+a+l+r+s+er++vEr++l+r+i n++aceg+
  cra_locus_24_iso_5_len_2218_ver_3 428 LRMVKSLNPKLVTVVEQDVNTNTAPFLPRFAEAYSYYSAVFDSLDATLSRDSQERMNVERQCLARDIINIIACEGE 503
                                        **************************************************************************** PP

                               GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                        +r+er e ++kWr+r+++aGF++ p+s+++ ++++ l+++++++ y+v+ee g l +gW+++ L+++SaWr
  cra_locus_24_iso_5_len_2218_ver_3 504 DRIERYEVAGKWRARMMMAGFSSSPISQSVKDEIRKLIKQYSER-YKVKEETGGLHFGWEEKILIVASAWR 573
                                        ******************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.734177554IPR005202Transcription factor GRAS
PfamPF035146.4E-133204573IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MSLVRSASAF ENRELYSLKS SSNNSGFPAS LFKPDKQQGI TCSTESYSQE SYDLKYFLDS  60
PSEEHTQASI SDVLENSFSS PHPSSYQLMA GQTSFTPAKR CDPYQFNYES EYLSSQGPEE  120
MDCDQDKVRL KLEELERELF DDNNVSEEEM YCHDHSTETD CEWPCPTKDL MLHESPKETS  180
SSDSNVSSIS SNKEASMTAP RTAKQMLFGC ATAIQEGNIS EASTMINMLR QKVSIQGDPS  240
ERIAAYMVEA LAARMAISGK GLYKALKCKE PPSYDRLAAM QVLFEVCPCF RFGFMAANGA  300
ILEAFKGEKR VHIVDFDINQ GSQYYTLLQT LARLPYKPTH LRLTGVDDPE SVQRAVGGLK  360
NIGQRLETLA GDLEIPFEFC AVAAKTADVT PAMLGCKPGD ALIVNFAFQL HHMPDESVST  420
VNQRDRLLRM VKSLNPKLVT VVEQDVNTNT APFLPRFAEA YSYYSAVFDS LDATLSRDSQ  480
ERMNVERQCL ARDIINIIAC EGEDRIERYE VAGKWRARMM MAGFSSSPIS QSVKDEIRKL  540
IKQYSERYKV KEETGGLHFG WEEKILIVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-612055736375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGPOPTR_0005s20890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429